Allograft Inflammatory Factor-1 (AIF-1) Human (E.coli)
| Type: Recombinant | |||||
| Source: E. coli | Species: Human | ||||
| Other names: AIF-1, Ionized Calcium-binding Adapter Molecule 1, Protein G1 | Product of BioVendor | ||||
| Product: | Size: | ||||
|---|---|---|---|---|---|
| New: RD172204100 | 0.1 mg | ||||
| Files: Datasheet PDF | |||||
Product details
Description
Total 155 aa; MW 17,7 kDa (calculated); N-terminal His-tag; 9 extra amino acids (highlighted);
Amino Acid Sequence
MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Source
E. coli
SDS-PAGE gel
|
12% SDS-PAGE separation of Human AIF-1 |
Formulation
Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5
Reconstitution
Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
Storage, Stability/Shelf Life
Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.
Applications
Western blotting
Shopping cart
Your cart is empty.
