Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

β-NGF Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:NGF-beta
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10247020 20 µg
RBG10247100 100 μg
RBG10247250 250 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Source

E. coli

Purity

98%

Biological Activity

determined by its ability to stimulate chick E9 DRG neurite outgrowth. The ED50 is 1.0 ng/ml, corresponding to a specific activity of 1×106 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules, Diabetology - Other Relevant Products, Neural tissue markers

Related Products Documents