Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

β-NGF Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:NGF-beta
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20106005 5 µg
RBG20106020 20 µg
RBG20106100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

β-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. β-NGF is a potent neurotrophic factor that signals through its receptor β-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. β-NGF also acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. The functional form of Recombinant Murine β-NGF is a non-covalently-linked homodimer of two 13.4 kDa, polypeptide monomers that each contain 120 amino acids and three disulfide bonds, which are required for biological activity.

Amino Acid Sequence

SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1×106 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules, Diabetology - Other Relevant Products, Neural tissue markers

Related Products Documents