Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

4-1BB Ligand Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:TNFSF9, CD137L
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10068020 20 µg
RBG10068100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

4–1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4–1BBL binds to its receptor 4–1BB and provides a co-stimulatory signal for T cell activation and expansion. The human 4–1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain and a 205 amino acid extracellular domain. The soluble form of 4–1BBL contains the TNF-like portion of the extracellular domain of 4–1BBL. Recombinant human 4–1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues.

Amino Acid Sequence

MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Source

E. coli

Purity

98%

Biological Activity

Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The ED50 for this effect is 5–10 ng/ml. Note: Results may vary with PBMC donors.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Immune Response, Infection and Inflammation, Transplantation

Related Products Docs