Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

4-1BB Receptor Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:TNFRSF9, CD137 antigen, T-cell antigen ILA
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10069005 5 µg
RBG10069020 20 µg
RBG10069100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

4–1BB Receptor, a member of the TNF superfamily of receptors, is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. 4–1BB Receptor binds to 4–1BBL to provide a co-stimulatory signal for T lymphocytes. Signaling by 4–1BB Receptor has been implicated in the antigen-presentation process and generation of cytotoxic T cells. The human 4–1BB Receptor gene codes for a 255 amino acid type I transmembrane protein containing a 17 amino acid N-terminal signal sequence, a 169 amino acid extracellular domain, a 27 amino acid transmembrane domain and a 42 amino acid cytoplasmic domain. Recombinant Human soluble 4–1BB Receptor is a 167 amino acid polypeptide (17.7 kDa), which contains the cysteine-rich TNFR-like extracellular domain of 4–1BB Receptor.

Amino Acid Sequence

MERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKNCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS

Source

E. coli

Purity

98%

Biological Activity

Determined by its inhibitory effect of the 4–1BBL mediated stimulation of IL-8 production by human PBMC. About 90% of inibition was seen using a concentration of 1µg for both 4–1BBL and 4–1BBR.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis

Related Products Documents