Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Activin B Human (BTI-Tn-5B1-4) Hi-5 Insect cells*

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:(BTI-Tn-5B1-4) Hi-5 Insect cells*
  • Other names:Activin beta-B, Inhibin beta-2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10053001 1 µg
RBG10053005 5 µg
RBG10053100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Activin B is a TGF-β family member that exhibits a wide range of biological activities, including regulation of embryogenesis, osteogenesis, hematopoiesis, reproductive physiology and hormone secretion from the hypothalamic, pituitary and gonadal glands. Activin B, like certain other members of the TGF-β family, signals through the ActRII receptor (Activin Receptor type II). Activins are homodimers or heterodimers of different β subunits. They are produced as precursor proteins with an amino terminal propeptide that is cleaved to release the C-terminal bioactive ligand. Human Activin B is a 25.6 kDa disulfide-linked homodimer consisting of two βB chains, each containing 115 amino acid residues.

Amino Acid Sequence

GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA

Source

(BTI-Tn-5B1-4) Hi-5 Insect cells*

Purity

95%

Biological Activity

The ED50 as determined by its ability to inhibit the proliferation of murine MPC-11 cells is 2.0 ng/ml, corresponding to a specific activity of 5×105 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Neural tissue markers

Related Products Docs