Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Adiponectin Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Adipocyte C1q and collagen domain-containing protein, Adipocyte complement-related 30 kDa protein, ACRP30, Adipose most abundant gene transcript 1 protein, apM-1, Gelatin-binding protein, ADIPOQ, ACDC, APM1, GBP28
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172023025 0.025 mg
RD172023100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNDYKDDDDK

Glu 1 to Gln 5 were confirmed by N-terminal sequencing

Source

HEK293

Purity

C-terminal flag tag

SDS-PAGE Gel

12% SDS-PAGE separation of Human A diponectin

  1. M.w. marker – 14, 21, 31, 45, 66, 97 kDa
  2. reduced and heated sample, 5μg/lane
  3. non-reduced and non-heated sample, 5μg/lane

Biological Activity

In vitro gluconeogenesis assay in primary hepatocytes was performed, showing the human adiponectin derived from mammalian cells can inhibit glucose production. The ED50 was ~6 µg/ml.

Endotoxin

< 0.1 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Filter your culture media/working solutions containing this product before using in cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

GFC to determine purity of the protein.

LAL to determine quantity of endotoxin.

Summary

Research topic

Chronic renal failure, Coronary artery disease, Diabetology - Other Relevant Products, Energy metabolism and body weight regulation

Summary

Adiponectin, also referred to as Acrp30, AdipoQ and GBP-28, is a recently discovered 244 aminoacid protein, the product of the apM1 gene, which is physiologically active and specifically and highly expressed in adipose cells. The protein belongs to the soluble defence collagen superfamily; it has a collagen-like domain structurally homologous with collagen VIII and X and complement factor C1q-like globular domain. Adiponectin forms homotrimers, which are the building blocks for higher order complexes found circulating in serum. Together, these complexes make up approximately 0.01% of total serum protein. Adiponectin receptors AdipoR1 and AdipoR2 have been recently cloned; AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. Paradoxically, adipose tissue-expressed adiponectin levels are inversely related to the degree of adiposity. Adiponectin concentrations correlate negatively with glucose, insulin, triglyceride concentrations, liver fat content and body mass index and positively with high-density lipoprotein-cholesterol levels, hepatic insulin sensitivity and insulin-stimulated glucose disposal. Adiponectin has been shown to increase insulin sensitivity and decrease plasma glucose by increasing tissue fat oxidation. Of particular interest is that low adiponectin serum levels predict type 2 diabetes independent of other risk factors. Adiponectin also inhibits the inflammatory processes of atherosclerosis suppressing the expression of adhesion and cytokine molecules in vascular endothelial cells and macrophages, respectively. This adipokine plays a role as a scaffold of newly formed collagen in myocardial remodelling after ischaemic injury and also stimulates angiogenesis by promoting cross-talk between AMP-activated protein kinase and Akt signalling in endothelial cells. Low serum adiponectin levels are found in patients with coronary artery disease. Moreover, high circulating levels of adiponectin are associated with decreased risk of myocardial infarction, independent of other factors. Altogether, adiponectin has the potential to become a clinically relevant parameter to be measured routinely in subjects at risk for type 2 diabetes, atherosclerosis and the metabolic syndrome.

Product References (17)

References

  • Berger E, Rome S, Vega N, Ciancia C, Vidal H. Transcriptome profiling inresponse to adiponectin in human cancer-derived cells. Physiol Genomics. 2010Sep;42A(1):61-70. doi: 10.1152/physiolgenomics.00013.2010. Epub 2010 Jun 22.PubMed PMID: 20571111. See more on PubMed
  • Conde J, Gomez R, Bianco G, Scotece M, Lear P, Dieguez C, Gomez-Reino J, Lago F, Gualillo O. Expanding the adipokine network in cartilage: identification andregulation of novel factors in human and murine chondrocytes. Ann Rheum Dis. 2011Mar;70(3):551-9. doi: 10.1136/ard.2010.132399. Epub 2011 Jan 7. PubMed PMID:21216818. See more on PubMed
  • Folco EJ, Rocha VZ, López-Ilasaca M, Libby P. Adiponectin inhibitspro-inflammatory signaling in human macrophages independent of interleukin-10. J Biol Chem. 2009 Sep 18;284(38):25569-75. doi: 10.1074/jbc.M109.019786. Epub 2009 Jul 18. PubMed PMID: 19617629; PubMed Central PMCID: PMC2757958. See more on PubMed
  • Greenstein AS, Khavandi K, Withers SB, Sonoyama K, Clancy O, Jeziorska M,Laing I, Yates AP, Pemberton PW, Malik RA, Heagerty AM. Local inflammation andhypoxia abolish the protective anticontractile properties of perivascular fat in obese patients. Circulation. 2009 Mar 31;119(12):1661-70. doi:10.1161/CIRCULATIONAHA.108.821181. Epub 2009 Mar 16. PubMed PMID: 19289637. See more on PubMed
  • Haugen F, Drevon CA. Activation of nuclear factor-kappaB by high molecularweight and globular adiponectin. Endocrinology. 2007 Nov;148(11):5478-86. Epub2007 Aug 16. PubMed PMID: 17702846. See more on PubMed
  • Jalovaara K, Santaniemi M, Timonen M, Jokelainen J, Kesäniemi YA, Ukkola O,Keinänen-Kiukaanniemi S, Rajala U. Low serum adiponectin level as a predictor of impaired glucose regulation and type 2 diabetes mellitus in a middle-aged Finnishpopulation. Metabolism. 2008 Aug;57(8):1130-4. doi:10.1016/j.metabol.2008.03.019. PubMed PMID: 18640392. See more on PubMed
  • Kamio N, Akifusa S, Yamaguchi N, Yamashita Y. Induction of granulocytecolony-stimulating factor by globular adiponectin via the MEK-ERK pathway. MolCell Endocrinol. 2008 Sep 24;292(1-2):20-5. doi: 10.1016/j.mce.2008.05.002. Epub 2008 May 9. PubMed PMID: 18555587. See more on PubMed
  • Kitajima K, Miura S, Yamauchi T, Uehara Y, Kiya Y, Rye KA, Kadowaki T, Saku K.Possibility of increasing cholesterol efflux by adiponectin and its receptorsthrough the ATP binding cassette transporter A1 in HEK293T cells. Biochem BiophysRes Commun. 2011 Jul 29;411(2):305-11. doi: 10.1016/j.bbrc.2011.06.131. Epub 2011Jun 28. PubMed PMID: 21740892. See more on PubMed
  • Lamers D, Famulla S, Wronkowitz N, Hartwig S, Lehr S, Ouwens DM, Eckardt K,Kaufman JM, Ryden M, Müller S, Hanisch FG, Ruige J, Arner P, Sell H, Eckel J.Dipeptidyl peptidase 4 is a novel adipokine potentially linking obesity to themetabolic syndrome. Diabetes. 2011 Jul;60(7):1917-25. doi: 10.2337/db10-1707.Epub 2011 May 18. PubMed PMID: 21593202; PubMed Central PMCID: PMC3121429. See more on PubMed
  • Mahadev K, Wu X, Donnelly S, Ouedraogo R, Eckhart AD, Goldstein BJ.Adiponectin inhibits vascular endothelial growth factor-induced migration ofhuman coronary artery endothelial cells. Cardiovasc Res. 2008 May 1;78(2):376-84.doi: 10.1093/cvr/cvn034. Epub 2008 Feb 10. PubMed PMID: 18267956. See more on PubMed
  • Maillard V, Uzbekova S, Guignot F, Perreau C, Ramé C, Coyral-Castel S, Dupont J. Effect of adiponectin on bovine granulosa cell steroidogenesis, oocytematuration and embryo development. Reprod Biol Endocrinol. 2010 Mar 10;8:23. doi:10.1186/1477-7827-8-23. PubMed PMID: 20219117; PubMed Central PMCID: PMC2845137. See more on PubMed
  • Murdolo G, Hammarstedt A, Schmelz M, Jansson PA, Smith U. Acutehyperinsulinemia differentially regulates interstitial and circulatingadiponectin oligomeric pattern in lean and insulin-resistant, obese individuals. J Clin Endocrinol Metab. 2009 Nov;94(11):4508-16. doi: 10.1210/jc.2009-0431. Epub2009 Oct 9. PubMed PMID: 19820029. See more on PubMed
  • Nigro E, Scudiero O, Sarnataro D, Mazzarella G, Sofia M, Bianco A, Daniele A. Adiponectin affects lung epithelial A549 cell viability counteracting TNFα andIL-1ß toxicity through AdipoR1. Int J Biochem Cell Biol. 2013 Jun;45(6):1145-53. doi: 10.1016/j.biocel.2013.03.003. Epub 2013 Mar 15. PubMed PMID: 23500159. See more on PubMed
  • Pisto P, Ukkola O, Santaniemi M, Kesäniemi YA. Plasma adiponectin--anindependent indicator of liver fat accumulation. Metabolism. 2011Nov;60(11):1515-20. doi: 10.1016/j.metabol.2011.03.009. Epub 2011 May 11. PubMed PMID: 21565369. See more on PubMed
  • Rodriguez PC, Ernstoff MS, Hernandez C, Atkins M, Zabaleta J, Sierra R, Ochoa AC. Arginase I-producing myeloid-derived suppressor cells in renal cell carcinomaare a subpopulation of activated granulocytes. Cancer Res. 2009 Feb15;69(4):1553-60. doi: 10.1158/0008-5472.CAN-08-1921. Epub 2009 Feb 5. PubMedPMID: 19201693; PubMed Central PMCID: PMC2900845. See more on PubMed
  • Sell H, Laurencikiene J, Taube A, Eckardt K, Cramer A, Horrighs A, Arner P,Eckel J. Chemerin is a novel adipocyte-derived factor inducing insulin resistancein primary human skeletal muscle cells. Diabetes. 2009 Dec;58(12):2731-40. doi:10.2337/db09-0277. Epub 2009 Aug 31. PubMed PMID: 19720798; PubMed Central PMCID:PMC2780878. See more on PubMed
  • Stejskal D, Proskova J, Solichova P. Adiponectin added into the plasma ofhealthy probands does not affect platelet aggregability. Biomed Pap Med Fac Univ Palacky Olomouc Czech Repub. 2006 Jul;150(1):89-90. PubMed PMID: 16936907. See more on PubMed
Summary References (17)

References to Adiponectin

  • Lam KS, Xu A. Adiponectin: protection of the endothelium. Curr Diab Rep. 2005, 5, 254–259.
  • Ding X, Saxena NK, Lin S, Xu A, Srinivasan S, Anania FA. The roles of leptin and adiponectin: a novel paradigm in adipocytokine regulation of liver fibrosis and stellate cell biology. Am J Pathol. 2005, 166, 1655–1669.
  • Xu A, Chan KW, Hoo RL, Wang Y, Tan KC, Zhang J, Chen B, Lam MC, Tse C, Cooper GJ, Lam KS. Testosterone selectively reduces the high molecular weight form of adiponectin by inhibiting its secretion from adipocytes. J Biol Chem. 2005, 280, 18073–18080.
  • Wang Y, Lam KS, Xu JY, Lu G, Xu LY, Cooper GJ, Xu A. Adiponectin inhibits cell proliferation by interacting with several growth factors in an oligomerization-dependent manner. J Biol Chem. 2005, 280, 18341–18347.
  • Ouchi N, Kobayashi H, Kihara S, Kumada M, Sato K, Inoue T, Funahashi T, Walsh K. Adiponectin stimulates angiogenesis by promoting cross-talk between AMP-activated protein kinase and Akt signaling in endothelial cells. J Biol Chem. 2004, 279, 1304–1309.
  • Ishikawa Y, Akasaka Y, Ishii T, Yoda-Murakami M, Choi-Miura NH, Tomita M, Ito K, Zhang L, Akishima Y, Ishihara M, Muramatsu M, Taniyama M. Changes in the distribution pattern of gelatinbinding protein of 28 kDa (adiponectin) in myocardial remodelling after ischaemic injury. Histopathology. 2003, 42, 43–52.
  • Diez JJ, Iglesias P. The role of the novel adipocyte-derived hormone adiponectin in human disease. Eur J Endocrinol. 2003, 148, 293–300.
  • Waki H, Yamauchi T, Kamon J, Ito Y, Uchida S, Kita S, Hara K, Hada Y, Vasseur F, Froguel P, Kimura S, Nagai R, Kadowaki T. Impaired multimerization of human adiponectin mutants associated with diabetes. Molecular structure and multimer formation of adiponectin. J Biol Chem. 2003, 278, 40352–40363.
  • Yamauchi T, Kamon J, Ito Y, Tsuchida A, Yokomizo T, Kita S, Sugiyama T, Miyagishi M, Hara K, Tsunoda M, Murakami K, Ohteki T, Uchida S, Takekawa S, Waki H, Tsuno NH, Shibata Y, Terauchi Y, Froguel P, Tobe K, Koyasu S, Taira K, Kitamura T, Shimizu T, Nagai R, Kadowaki T. Cloning of adiponectin receptors that mediate antidiabetic metabolic effects. Nature. 2003, 423, 762–769.
  • Yamauchi T, Kamon J, Waki H, Imai Y, Shimozawa N, Hioki K, Uchida S, Ito Y, Takakuwa K, Matsui J, Takata M, Eto K, Terauchi Y, Komeda K, Tsunoda M, Murakami K, Ohnishi Y, Naitoh T, Yamamura K, Ueyama Y, Froguel P, Kimura S, Nagai R, Kadowaki T. Globular adiponectin protected ob/ob mice from diabetes and ApoE-deficient mice from atherosclerosis. J Biol Chem. 2003, 278, 2461–2468.
  • Daimon M, Oizumi T, Saitoh T, Kameda W, Hirata A, Yamaguchi H, Ohnuma H, Igarashi M, Tominaga M, Kato T. Decreased serum levels of adiponectin are a risk factor for the progression to type 2 diabetes in the Japanese Population: the Funagata study. Diabetes Care. 2003 Jul;26(7):2015–20.
  • Pajvani UB, Du X, Combs TP, Berg AH, Rajala MW, Schulthess T, Engel J, Brownlee M, Scherer PE. Structure-function studies of the adipocyte-secreted hormone Acrp30/adiponectin. Implications for metabolic regulation and bioactivity. J Biol Chem. 2003, 278, 9073–9085.
  • Spranger J, Kroke A, Mohlig M, Bergmann MM, Ristow M, Boeing H, Pfeiffer AF. Adiponectin and protection against type 2 diabetes mellitus. Lancet. 2003, 361, 226–228.
  • Kondo H, Shimomura I, Matsukawa Y, Kumada M, Takahashi M, Matsuda M, Ouchi N, Kihara S, Kawamoto T, Sumitsuji S, Funahashi T, Matsuzawa Y. Association of adiponectin mutation with type 2 diabetes: a candidate gene for the insulin resistance syndrome. Diabetes. 2002, 51, 2325–2328.
  • Wang Y, Xu A, Knight C, Xu LY, Cooper GJ. Hydroxylation and glycosylation of the four conserved lysine residues in the collagenous domain of adiponectin. Potential role in the modulation of its insulin-sensitizing activity. J Biol Chem. 2002, 277, 19521–19529.
  • Tsao TS, Lodish HF, Fruebis J. ACRP30, a new hormone controlling fat and glucose metabolism. Eur J Pharmacol. 2002, 440, 213–21.
  • Das K, Lin Y, Widen E, Zhang
Related Products Docs