Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Aeromonas Aminopeptidase E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
Please select your region to see available products and prices.
Cat. No. Size Price


RBG100510100 100 μg
RBG100511000 1mg
RBG100510500 500 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG

Source

E. coli

Purity

98%

Biological Activity

Sequentially cleaves N-terminal amino acids except E, D and X-P.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Others

Summary

Proteases (also called Proteolytic Enzymes, Peptidases or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at or adjacent to specific residues or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes including prenatal and postnatal development, reproduction, signal transduction, the immune response, various autoimmune and degenerative diseases and cancer. They are also an important research tool, frequently used in the analysis and production of proteins. Recombinant Aeromonas Aminopeptidase is a 31.4 kDa protein containing 291 amino acid residues.

Related Products Docs