Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Agouti-Related Protein Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:AGRP, AGRT, ART
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172030100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 128 AA. MW: 14.4 kDa (calculated). UniProtKB acc.no. O00253. N-Terminal His-tag, 16 extra AA (highlighted).

Amino Acid Sequence

MKHHHHHHHMLVPRGSAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Source

E. coli

Purity

>95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human AGRP
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 5mM TRIS, 25mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation

Summary

Agouti-related protein is an endogenous antagonist of hypothalamic alpha-melanocortin receptors MC3R and MC4R with potent orexigenic activity. Although a complete deletion of the AGRP gene does not produce any significant metabolic phenotypes, reduction in AGRP expression by RNA interference is associated with increased metabolic rate along with reduced weight gain. In hypothalamus, it is produced by neurons in the medial portion of arcuate nucleus, which produce also the potent orexigenic peptide Neuropeptide Y (NP-Y). Another site of central AGRP production is the hypothalamic nucleus. AGRP encompasses 132 amino acid residues and its alpha-melanocortin inhibiting activity results in a 34 amino acid cystine knot domain within the C-terminal (87–132) portion of the protein. Both AGRP and NP-Y expression was shown to be supressed by leptin. Central administration of AGRP induces hyperphagia and increased gain in body weight in rodents, but may also exert metabolic effects even when hyperphagia is prevented. In the absence of hyperphagia, intracerebral­ventricular administration of AGRP caused significant increases in plasma leptin and insulin concentrations (two-fold and 1.5-fold, respectively) and fat pad mass. In the perifery, AGRP mRNA was found in adrenal glands, lung, testis, ovary, skeletal muscle and adipose tissue in humans or rodents. In the adrenals, it was shown that AGRP antagonizes glucosteroid production mediated by MC4R. AGRP could then modulate locally the functions of some peripheral tissues such as adrenals. In human and rat serum, detectable levels of AGRP-like activity were reported in the lower picogram range. The serum AGRP levels were elevated in obese humans compared to lean controls and increased with fasting in rats.

References to Summary

References to Agouti-Related Protein

  • Argyropoulos G, Rankinen T, Bai F, Rice T, Province MA, Leon AS, Skinner JS, Wilmore JH, Rao DC, Bouchard C. The agouti-related protein and body fatness in humans. Int J Obes Relat Metab Disord. 2003 Feb;27 (2):276-80
  • Dinulescu DM, Cone RD. Agouti and agouti-related protein: analogies and contrasts. J Biol Chem. 2000 Mar 10;275 (10):6695-8
  • Korner J, Wissig S, Kim A, Conwell IM, Wardlaw SL. Effects of agouti-related protein on metabolism and hypothalamic neuropeptide gene expression. J Neuroendocrinol. 2003 Dec;15 (12):1116-21
  • Olszewski PK, Wickwire K, Wirth MM, Levine AS, Giraudo SQ. Agouti-related protein: appetite or reward?. Ann N Y Acad Sci. 2003 Jun;994:187-91
  • Shen CP, Wu KK, Shearman LP, Camacho R, Tota MR, Fong TM, Van der Ploeg LH. Plasma agouti-related protein level: a possible correlation with fasted and fed states in humans and rats. J Neuroendocrinol. 2002 Aug;14 (8):607-10
Related Products Documents