Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

AITRL Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Activation-induced TNFR member Ligand, TNFSF18, GITRL, TL-6
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10055005 5 µg
RBG10055020 20 µg
RBG10055100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

AITRL, a member of the TNF superfamily, is expressed in endothelial cells, and signals through the AITR receptor. AITRL regulates T-cell proliferation and survival, and effectuates the interaction between T lymphocytes and endothelial cells. The AITRL gene codes for a type II transmembrane protein comprised of 177 amino acids, including a 28 amino acid cytoplasmic region, a 21 amino acid transmembrane domain and a 128 amino acid extracellular domain. Recombinant Human soluble AITRL is a 14.4 kDa protein, containing 127 amino acid residues corresponding to the extracellular domain of AITRL.

Amino Acid Sequence

METAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 1.0–10.0 ng/ml. Note: Results may vary with PBMC donors.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Immune Response, Infection and Inflammation

Related Products Documents