Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Allograft Inflammatory Factor 1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:AIF-1, Ionized calcium-binding adapter molecule 1, Protein G1, AIF1, G1, IBA1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172204100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 155 aa; MW 17,7 kDa (calculated); UniProtKB acc.no. P55008; N-terminal His-tag; 9 extra amino acids (highlighted);

Amino Acid Sequence

MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Source

E. coli

SDS-PAGE Gel

14% SDS-PAGE separation of Human AIF-1
1. reduced and heated sample, 5μg/lane
2. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Cardiovascular disease, Immune Response, Infection and Inflammation, Transplantation

Summary

Allograft inflammatory factor 1 (AIF-1), is a 17kDa cytoplasm, calcium-binding protein that in humans is encoded by the AIF1 gene. This gene is induced by cytokines and interferon. Three transcript variants encoding different isoforms have been found for this gene. The AIF1 gene is conserved in chimpanzee, Rhesus monkey, dog, cow, mouse, and rat. Allograft inflammatory factor 1 plays a important role in vascular inflammation. AIF-1 is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma. AIF-1 also plays an important role in immune response and vasculopathy in allografts. AIF-1 was found in both cardiac allografts and hearts with other cardiac cellular diseases. In cardiac allografts, expression levels of AIF-1 in both cardiomyocytes and mononuclear cells directly correlated with the severity of cardiac cellular rejection. Thus, AIF-1 shows promise that it can be a potential biomarker for cardiac allograft rejection. AIF-1 is a protein whose expression in transplanted human hearts correlates with rejection and development of coronary artery vasculopathy (CAV). AIF-1 is crucial for the survival and pro-inflammatory activity of macrophages. Pro-inflammatory cytokines induced p-regulation of AIF-1 in macrophages. AIF-1 promote the activation and proliferation of T-lymphocytes and enhances lymphocyte migration. In human coronary artery vasculopathy, AIF-1 is expressed in T lymphocytes, and expression increases when T cells are activated. Increased numbers of AIF-1 immunoreactive macrophages/mi­croglial cells were observed in focal human brain infarctions and human traumatic brain injury, in inflammatory lesions of a rat model of autoimmune disease and other disorders. Functional studies revealed that AIF-1 is secreted into the blood stream during experimental autoimmune neuritis. The results of several studies suggest that enhanced AIF-1 expression leads to augmented incorporation of degenerated LDL by macrophages and promotes development of atherosclerotic vasculopathy. AIF-1 is also expressed in tissues from patients with systemic sclerosis.

Summary References (10)

References to Allograft Inflammatory Factor 1

  • Broglio L, Erne B, Tolnay M, Schaeren-Wiemers N, Fuhr P, Steck AJ, Renaud S. Allograft inflammatory factor-1: a pathogenetic factor for vasculitic neuropathy. Muscle Nerve. 2008 Oct;38 (4):1272-9
  • Do Carmo S, Fournier D, Mounier C, Rassart E. Human apolipoprotein D overexpression in transgenic mice induces insulin resistance and alters lipid metabolism. Am J Physiol Endocrinol Metab. 2009 Apr;296 (4):E802-11
  • Eichinger A, Nasreen A, Kim HJ, Skerra A. Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein D. J Biol Chem. 2007 Oct 19;282 (42):31068-75
  • Eichinger A, Nasreen A, Kim HJ, Skerra A. Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein D. J Biol Chem. 2007 Oct 19;282 (42):31068-75
  • Gysemans C, Callewaert H, Moore F, Nelson-Holte M, Overbergh L, Eizirik DL, Mathieu C. Interferon regulatory factor-1 is a key transcription factor in murine beta cells under immune attack. Diabetologia. 2009 Nov;52 (11):2374-84
  • Jiang W, Kong L, Wu X, Pu L, Wang X. Allograft inflammatory factor-1 is up-regulated in warm and cold ischemia-reperfusion injury in rat liver and may be inhibited by FK506. J Surg Res. 2011 Jan;165 (1):158-64
  • Perdomo G, Dong HH. Allograft Inflammatory Factor 1 in lipid metabolism and its functional implication in atherosclerosis and aging. Aging. 2009;:1(1): 17 – 27
  • Rassart E, Bedirian A, Do Carmo S, Guinard O, Sirois J, Terrisse L, Milne R. Apolipoprotein D. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2):185-98
  • Yang ZF, Ho DW, Lau CK, Lam CT, Lum CT, Poon RT, Fan ST. Allograft inflammatory factor-1 (AIF-1) is crucial for the survival and pro-inflammatory activity of macrophages. Int Immunol. 2005 Nov;17 (11):1391-7
  • Zhou X, He Z, Henegar J, Allen B, Bigler S. Expression of allograft inflammatory factor-1 (AIF-1) in acute cellular rejection of cardiac allografts. Cardiovasc Pathol. 2011 Sep-Oct;20 (5):e177-84
Related Products Docs