Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Alpha-1-Acid Glycoprotein NATIVE, Human serum

  • Regulatory status:RUO
  • Type:Native protein
  • Source:Human pooled serum
  • Other names:AGP1, Orosomucoid-1, OMD1, ORM1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD162340500 0.5 mg
PubMed Product Details
Technical Data

Type

Native protein

Description

Native protein isolated from human pooled serum, 183 AA, MW 21,560 kDa (calculated without glycosylation).

Amino Acid Sequence

QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES

Source

Human pooled serum

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

SDS-PAGE analysis of Human Alpha-1-acid glycoprotein 1 NATIVE protein 12% gel stained with Coomassie Brillant Blue R250

  1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
  2. reduced and heated sample, 2.5μg/lane
  3. non-reduced and non-heated sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7,5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies, Immunological methods

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only. All blood samples used for protein preparation were tested and found negative for HBsAg, anti-HCV, HIV Ag/Ab, and syphilis. Since no test can absolutely assure the absence of all infectious agents, this product should be handled as a potential biohazard.

Summary

Research topic

Immune Response, Infection and Inflammation, Oncology

Summary

Alpha-1 Acidic-Glycoprotein is an acute phase protein, which is nonspecifically increased in the plasma during acute inflammation. It becomes the indication for acute and chronic inflammatory diseases and tissue injury.

References to Summary

References to Alpha-1-Acidic Glycoprotein

  • Christiansen MS, Hesse D, Ekbom P, Hesse U, Damm P, Hommel E, Feldt-Rasmussen B, Mathiesen E. Increased urinary orosomucoid excretion predicts preeclampsia in pregnant women with pregestational type 1 diabetes. Diabetes Res Clin Pract. 2010 Jul;89 (1):16-21
  • Christiansen MS, Hommel E, Magid E, Feldt-Rasmussen B. Orosomucoid in urine predicts cardiovascular and over-all mortality in patients with Type II diabetes. Diabetologia. 2002 Jan;45 (1):115-20
  • Harley J, Roberts R, Joyce P, Mulder R, Luty S, Frampton C, Kennedy M. Orosomucoid influences the response to antidepressants in major depressive disorder. J Psychopharmacol. 2010 Apr;24 (4):531-5
  • Ligresti G, Aplin AC, Dunn BE, Morishita A, Nicosia RF. The acute phase reactant orosomucoid-1 is a bimodal regulator of angiogenesis with time- and context-dependent inhibitory and stimulatory properties. PLoS One. 2012;7 (8):e41387
  • Sochacka J, Pawelczak B. Characterization of 6-mercaptopurine binding site on human alpha1-acid glycoprotein (orosomucoid) using molecular docking. Acta Pol Pharm. 2012 Jan-Feb;69 (1):161-6
Related Products Docs