Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Amphiregulin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:AR, AREG, Colorectum cell-derived growth factor (CRDGF)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10056010 10 µg
RBG10056050 50 µg
RBG10056100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Amphiregulin is an EGF related growth factor that signals through the EGF/TGF-α receptor, and stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s ex­tracellular domain is proteolytically processed to release the mature protein. There are 6 conserved cysteine residues, which form 3 intramolecular disulfide bonds essential for biological activity. Recombinant Human Amphiregulin is an 11.3 kDa glycoprotein consisting of 98 amino acid residues.

Amino Acid Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

Source

E. coli

Purity

95%

Biological Activity

Determined by its ability to stimulate the proliferation of mouse Balb/c 3T3 cells. The expected ED50 for this effect is 5–10 ng/ml.

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation, Neural tissue markers, Oncology

Related Products Documents