Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Angiopoietin-Like Protein 4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Angiopoietin-related protein 4, Hepatic fibrinogen/angiopoietin-related protein, HFARP, ANGPTL4, ARP4, HFARP, PGAR, PP1158, PSEC0166, UNQ171/PRO197, FIAF
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172073025 0.025 mg
RD172073100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 220 AA. MW: 25 kDa (calculated). UniProtKB acc.no. Q9BY76. N-Terminal His-tag, 16 extra AA (highlighted).

Amino Acid Sequence

MRGSHHHHHHGMASHMGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQR

Source

E. coli

Purity

>95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human ANGPTL4
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 10μg/lane
3. non-reduced and non-heated sample,10μg/lane

Biological Activity

Effects of ANGPTL4 on serum levels of triglycerides, on blood glucose and on serum cholesterol levels in C57BL/6J mice.

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/mL solution in 30 mM acetate buffer, pH 4.0

Reconstitution

Add 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/mL. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA, Biologically active protein

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation

Summary

Angiopoietin-like protein 4 (ANGPTL4) is a secreted 50 kD protein that modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). ANGPTL4 was identified as a gene that is induced by fasting, and during 3T3-L1 preadipocyte differentiation, and was thus named HFARP (hepatic fibrinogen/an­giopoietin-related protein), FIAF (fasting-induced adipose factor), and PGAR (PPAR-angiopoietin related). It is one of the seven members of the angiopoietin-like family. Angptl4 is expressed ubiquitously, predominantly in adipose tissue, liver, placenta, myocardium, keratinocytes, podocytes, intestine, and pituitary gland. ANGPTL4 is a fusion protein consisting of an N-terminal coiled-coil domain and a C-terminal fibrinogen-like domain. These two domains have been shown to have distinct biological functions. The N-terminal domain is responsible for the inhibitory effects on LPL, converting the active form of LPL into an inactive form, and the C-terminus mediates its antiangiogenic functions. Interestingly, these two domains are separated by a short linker that can be cleaved after secretion. Upon secretion into the circulation, ANGPTL4 is cleaved into an N-terminal domain and a C-terminal fibrinogen-like domain. The N-terminal peptide circulates as an oligomer, and the fibrinogen-like domain circulates as a monomer. The N-terminal domain of ANGPTL4 interacts directly but transiently with LPL, triggering a stable conformational switch in LPL that irreversibly inactivates the enzyme. Cleavage of ANGPTL4 appears to be tissue-dependent in humans; liver secretes cleaved ANGPTL4, whereas adipose tissue secretes the full-length form. In mice the full-length form of ANGPTL4 is physically associated with HDL, whereas truncated ANGPTL4 is associated with low density lipoprotein. In humans, both full-length and truncated ANGPTL4 are associated with HDL. ANGPTL4 expression is upreguated by fasting, free fatty acids, PARR agonists, acute phase response, glucocorticoids, and downregulated by insulin. ANGPTL4 has been implicated in a variety of diseases, including cardiovascular disease, cancer metastasis, obesity, diabetes, wound repair, inflammation, arthritis and nephrotic syndrome. Serum or plasma levels were determined in a limited number of studies. ANGPTL4 serum levels display high variability between individuals ranging from 2 to 158 ng/ml. In post-heparin plasma, ANGPTL4 is increased. ANGPTL4 correlates positively with age, body fat mass, waist-hip-ratio and free faty acids but negatively with plasma high-density lipoprotein cholesterol. No correlation with triglycerides was observed in one study. ANGPTL4 is a positive acute phase protein and its increase could contribute to the hypertriglyce­ridemia that characteristically occurs during the acute phase response by inhibiting LPL activity.

References to Product

References

  • Lamounier-Zepter V, Look C, Alvarez J, Christ T, Ravens U, Schunck WH, Ehrhart-Bornstein M, Bornstein SR, Morano I. Adipocyte fatty acid-binding protein suppresses cardiomyocyte contraction: a new link between obesity and heart disease. Circ Res. 2009 Aug 14;105 (4):326-34
  • Padua D, Zhang XH, Wang Q, Nadal C, Gerald WL, Gomis RR, Massague J. TGFbeta primes breast tumors for lung metastasis seeding through angiopoietin-like 4. Cell. 2008 Apr 4;133 (1):66-77
References to Summary

References to Angiopoietin-Like Protein 4

  • Cazes A, Galaup A, Chomel C, Bignon M, Brechot N, Le Jan S, Weber H, Corvol P, Muller L, Germain S, Monnot C. Extracellular matrix-bound angiopoietin-like 4 inhibits endothelial cell adhesion, migration, and sprouting and alters actin cytoskeleton. Circ Res. 2006 Nov 24;99 (11):1207-15
  • Folsom AR, Peacock JM, Demerath E, Boerwinkle E. Variation in ANGPTL4 and risk of coronary heart disease: the Atherosclerosis Risk in Communities Study. Metabolism. 2008 Nov;57 (11):1591-6
  • Galaup A, Cazes A, Le Jan S, Philippe J, Connault E, Le Coz E, Mekid H, Mir LM, Opolon P, Corvol P, Monnot C, Germain S. Angiopoietin-like 4 prevents metastasis through inhibition of vascular permeability and tumor cell motility and invasiveness. Proc Natl Acad Sci U S A. 2006 Dec 5;103 (49):18721-6
  • Hermann LM, Pinkerton M, Jennings K, Yang L, Grom A, Sowders D, Kersten S, Witte DP, Hirsch R, Thornton S. Angiopoietin-like-4 is a potential angiogenic mediator in arthritis. Clin Immunol. 2005 Apr;115 (1):93-101
  • Kersten S, Lichtenstein L, Steenbergen E, Mudde K, Hendriks HF, Hesselink MK, Schrauwen P, Muller M. Caloric restriction and exercise increase plasma ANGPTL4 levels in humans via elevated free fatty acids. Arterioscler Thromb Vasc Biol. 2009 Jun;29 (6):969-74
  • Le Jan S, Amy C, Cazes A, Monnot C, Lamande N, Favier J, Philippe J, Sibony M, Gasc JM, Corvol P, Germain S. Angiopoietin-like 4 is a proangiogenic factor produced during ischemia and in conventional renal cell carcinoma. Am J Pathol. 2003 May;162 (5):1521-8
  • Robciuc MR, Tahvanainen E, Jauhiainen M, Ehnholm C. Quantitation of serum angiopoietin-like proteins 3 and 4 in a Finnish population sample. J Lipid Res. 2010 Apr;51 (4):824-31
  • Stejskal D, Karpisek M, Reutova H, Humenanska V, Petzel M, Kusnierova P, Vareka I, Varekova R, Stejskal P. Angiopoietin-like protein 4: development, analytical characterization, and clinical testing of a new ELISA. Gen Physiol Biophys. 2008 Mar;27 (1):59-63
  • Sukonina V, Lookene A, Olivecrona T, Olivecrona G. Angiopoietin-like protein 4 converts lipoprotein lipase to inactive monomers and modulates lipase activity in adipose tissue. Proc Natl Acad Sci U S A. 2006 Nov 14;103 (46):17450-5
  • Xu A, Lam MC, Chan KW, Wang Y, Zhang J, Hoo RL, Xu JY, Chen B, Chow WS, Tso AW, Lam KS. Angiopoietin-like protein 4 decreases blood glucose and improves glucose tolerance but induces hyperlipidemia and hepatic steatosis in mice. Proc Natl Acad Sci U S A. 2005 Apr 26;102 (17):6086-91
Related Products Documents