Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Apo-SAA Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG100640010 10 µg
RBG100640050 50 µg
RBG100641000 1mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Human Apo-SAA is a 104 amino acid polypeptide that circulates primarily in association with high-density lipoproteins (HDL). The level of Apo-SAA, normally 1–5 μg/ml in plasma, increases 500–1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apolipoprotein. The human SAA gene codes for a 122 amino acid polypeptide, which contains an 18 amino acid N-terminal signal sequence. Recombinant Apo-SAA is a consensus SAA molecule corresponding to human Apo-SAA1α, except for the presence of an N-terminal methionine, the substitution of asparagine for aspartic acid at position 60, and arginine for histidine at position 71 (the latter two substituted residues are present in Apo-SAA2β). The calculated molecular weight of Recombinant Human Apo-SAA is 11.7 kDa.

Amino Acid Sequence

MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISNARENIQRFFGRGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

Source

E. coli

Purity

98%

Biological Activity

Tested by its ability to down-regulate lipid biosynthesis in aortic smooth muscle cells. The effective concentration was found to be 4 µM.* * Schreiber, BM. et al. Biochem J. 1999 Nov 15; 344 Pt 1:7–13

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease

Related Products Documents