Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Apo-SAA1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10065010 10 µg
RBG10065050 50 µg
RBG10065100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Serum amyloid A proteins (SAA) represents a family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). The level of Apo-SAA, normally 1–5 μg/ml in plasma, increases 500–1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apolipoprotein. The human SAA gene codes for a 122 amino acid nonglycosylated polypeptide, which contains an 18 amino acid N-terminal sequence. Recombinant Human Apo-SAA1 is an 11.7 kDa protein containing 105 amino acid residues.

Amino Acid Sequence

MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human monocytes using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease

Related Products Documents