Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

ApoE3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Apoprotein E3
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG100620100 100 μg
RBG100621000 1mg
RBG100620500 500 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Source

E. coli

Purity

90%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 20 mM Sodium Phosphate, pH 7.8 + 0.5 mM DTT to a concentration of 1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease

Summary

ApoE3 belongs to a group of proteins that bind reversibly with lipoprotein and play an important role in lipid metabolism. In addition to facilitating solublization of lipids, these proteins help to maintain the structural integrity of lipoproteins, serve as ligands for lipoprotein receptors and regulate the activity of enzymes involved in lipid metabolism. Sig­nificant quantities of ApoE are produced in liver and brain and to some extent in almost every organ. ApoE exists in three major isoforms; E2, E3 and E4, which differ from one another by a single amino-acid substitution. E3 is the most common isoform and is present in 40–90% of the population. Recombinant human ApoE3 is a 34.0 kDa protein containing 299 amino acid residues.

Related Products Docs