Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Apolipoprotein M Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Apo M, Protein G3a, G3a, G3A, NG20
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172129100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 179 AA. MW: 20 kDa (calculated), N-Terminal Flag-tag (13 extra AA). UniProt entry O95445.

Amino Acid Sequence

HVDYKDDDDKPAGCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Source

HEK293

Purity

Purity as determined by densitometric image analysis  > 90%

SDS-PAGE Gel

12% SDS-PAGE separation of Human ApoM
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 5μg/lane
3. non-reduced and non-boiled sample, 5μg/lane

Endotoxin

<1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Immune Response, Infection and Inflammation, Lipoprotein metabolism

Summary

Human Apolipoprotein M (ApoM, protein G3a, NG20-like protein NG20), is a protein that in humans is encoded by the APOM gene. Two different isoforms have been found for this gene. ApoM is a secreted 25kDa member of the lipocalin protein family consisting of 188 amino acids. Human APOM shares sequence identity with pig (91%) and mouse (80%) APOM. The apolipoproteins are a structurally-unrelated group of proteins that all have some role in the transport of lipids in blood. Apolipoproteins plus phospholipids, cholesterol and triglycerides, form spherical particles with a lipid/hydrophobic center and a (apolipo)protein coat. The apolipoprotein coat promotes aqueous solubility and serves as a ligand for lipoprotein receptors. HDL may contain apoliporoteins A,C, D,E, J, L and M, while LDL contains apolipoproteins B and E. Areas of investigation: Lipoprotein metabolism, Obesity, Atherosclerosis, Diabetes mellitus, Immune Response, Infection and Inflammation.

Related Products Documents