Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

APRIL Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:TNF 13, TALL 2, TRDL 1, CD256 antigen , A Proliferation-Inducing Ligand, TNFSF13, TRDL-1α
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20054005 5 µg
RBG20054020 20 µg
RBG20054100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

APRIL, a member of the TNF superfamily, is expressed in monocytes, macrophages, certain transformed cell lines, certain cancers of the colon, and lymphoid tissues. APRIL, along with another TNF family member, BAFF, competes for two receptors, TACI and BCMA. APRIL has the ability to stimulate proliferation of various tumor cell lines, including Jurkat T cells and MCF-7 carcinoma cells. Like BAFF, APRIL also stimulates the proliferation of B and T cells. The human APRIL gene codes for at least four alternatively spliced transcriptional variants, which give rise to different isoforms of the APRIL precursor protein. All isoforms can be cleaved by the protease, furin, to release a soluble C-terminal fragment, which comprises the TNF-like receptor binding of the APRIL precursor. Recombinant Murine APRIL is a soluble 21.9 kDa protein, consisting of 192 amino acid residues.

Amino Acid Sequence

MRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKDSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL

Source

E. coli

Purity

98%

Biological Activity

Measured by its ability to induce cell proliferation of activated T cells.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cytokines and chemokines and related molecules, Oncology, Animal studies

Summary

APRIL (A PRoliferation-Inducing Ligand) is a member of the tumor necrosis factor family. APRIL shows high levels of expression in tumors of different origin and low level of expression in normal cells. APRIL shares two TNF receptor family members, TACI and BCMA with another TNF homolog, BlyS/BAFF both of which have been reported to play a role in autoimmune disease and cancer. The gene encoding the APRIL protein is localized to chromosome 17g 13.3. APRIL appears to play a role in T-independent type II antigen responses and T cell survival, but can also induce proliferation/sur­vival of non-lymphoid cells. Local production of APRIL was found in arthritic joints of patients with inflammatory arthritis. Biologically active BlyS/BAFF and APRIL heterotrimers are expressed in patients with systemic immune-based rheumatic diseases. A soluble form of the high affinity BCMA receptor has been shown to inhibit the proliferative activity of APRIL in vitro, thus decreasing tumor cell proliferation, while APRIL-transfected cells show an increased rate of tumor growth very directly, suggesting that APRIL is implicated in the regulation of tumor cell growth.

References to Summary

References to APRIL

  • Hahne M, Kataoka T, Schroter M, Hofmann K, Irmler M, Bodmer JL, Schneider P, Bornand T, Holler N, French LE, Sordat B, Rimoldi D, Tschopp J. APRIL, a new ligand of the tumor necrosis factor family, stimulates tumor cell growth. J Exp Med. 1998 Sep 21;188 (6):1185-90
  • Kelly K, Manos E, Jensen G, Nadauld L, Jones DA. APRIL/TRDL-1, a tumor necrosis factor-like ligand, stimulates cell death. Cancer Res. 2000 Feb 15;60 (4):1021-7
  • Litinskiy MB, Nardelli B, Hilbert DM, He B, Schaffer A, Casali P, Cerutti A. DCs induce CD40-independent immunoglobulin class switching through BLyS and APRIL. Nat Immunol. 2002 Sep;3 (9):822-9
  • Lopez-Fraga M, Fernandez R, Albar JP, Hahne M. Biologically active APRIL is secreted following intracellular processing in the Golgi apparatus by furin convertase. EMBO Rep. 2001 Oct;2 (10):945-51
  • Mackay F, Ambrose C. The TNF family members BAFF and APRIL: the growing complexity. Cytokine Growth Factor Rev. 2003 Jun-Aug;14 (3-4):311-24
  • Mackay F, Schneider P, Rennert P, Browning J. BAFF AND APRIL: a tutorial on B cell survival. Annu Rev Immunol. 2003;21:231-64
  • MacLennan I, Vinuesa C. Dendritic cells, BAFF, and APRIL: innate players in adaptive antibody responses. Immunity. 2002 Sep;17 (3):235-8
  • Marsters SA, Yan M, Pitti RM, Haas PE, Dixit VM, Ashkenazi A. Interaction of the TNF homologues BLyS and APRIL with the TNF receptor homologues BCMA and TACI. Curr Biol. 2000 Jun 29;10 (13):785-8
  • Medema JP, Planelles-Carazo L, Hardenberg G, Hahne M. The uncertain glory of APRIL. Cell Death Differ. 2003 Oct;10 (10):1121-5
  • Patel DR, Wallweber HJ, Yin J, Shriver SK, Marsters SA, Gordon NC, Starovasnik MA, Kelley RF. Engineering an APRIL-specific B cell maturation antigen. J Biol Chem. 2004 Apr 16;279 (16):16727-35
  • Rennert P, Schneider P, Cachero TG, Thompson J, Trabach L, Hertig S, Holler N, Qian F, Mullen C, Strauch K, Browning JL, Ambrose C, Tschopp J. A soluble form of B cell maturation antigen, a receptor for the tumor necrosis factor family member APRIL, inhibits tumor cell growth. J Exp Med. 2000 Dec 4;192 (11):1677-84
  • Roschke V, Sosnovtseva S, Ward CD, Hong JS, Smith R, Albert V, Stohl W, Baker KP, Ullrich S, Nardelli B, Hilbert DM, Migone TS. BLyS and APRIL form biologically active heterotrimers that are expressed in patients with systemic immune-based rheumatic diseases. J Immunol. 2002 Oct 15;169 (8):4314-21
  • Roth W, Wagenknecht B, Klumpp A, Naumann U, Hahne M, Tschopp J, Weller M. APRIL, a new member of the tumor necrosis factor family, modulates death ligand-induced apoptosis. Cell Death Differ. 2001 Apr;8 (4):403-10
  • Tan SM, Xu D, Roschke V, Perry JW, Arkfeld DG, Ehresmann GR, Migone TS, Hilbert DM, Stohl W. Local production of B lymphocyte stimulator protein and APRIL in arthritic joints of patients with inflammatory arthritis. Arthritis Rheum. 2003 Apr;48 (4):982-92
  • Varfolomeev E, Kischkel F, Martin F, Seshasayee D, Wang H, Lawrence D, Olsson C, Tom L, Erickson S, French D, Schow P, Grewal IS, Ashkenazi A. APRIL-deficient mice have normal immune system development. Mol Cell Biol. 2004 Feb;24 (3):997-1006
  • Xu S, Lam KP. B-cell maturation protein, which binds the tumor necrosis factor family members BAFF and APRIL, is dispensable for humoral immune responses. Mol Cell Biol. 2001 Jun;21 (12):4067-74
  • Yu G, Boone T, Delaney J, Hawkins N, Kelley M, Ramakrishnan M, McCabe S, Qiu WR, Kornuc M, Xia XZ, Guo J, Stolina M, Boyle WJ, Sarosi I, Hsu H, Senaldi G, Theill LE. APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity. Nat Immunol. 2000 Sep;1 (3):252-6
Related Products Documents