Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Argonaute-2 N-Terminal Region Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:HEK293
  • Other names:Argonaute2, hAgo2, Argonaute RISC catalytic component 2, Eukaryotic translation initiation factor 2C, eIF-2C 2, eIF2C 2, PAZ Piwi domain protein, PPD, Protein slicer, AGO2, EIF2C2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172565100-B 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant

Description

Total 210 AA. MW: 23.7 kDa (calculated). UniProtKB acc. no. Q9UKV8 (Met1–Phe200). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASMYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWF

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 90%

SDS-PAGE Gel

14 % SDS-PAGE separation of Argonaute-2 N200 Human (E.coli):

  1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
  2. Reduced and boiled sample, 2.5 μg/lane
  3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in 50 mM acetate buffer, pH 4.

Reconstitution

Add 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of 0.5 mg/ml and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. In higher concentrations the solubility of this antigen is limited.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Related Products
Documents