Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

BAFF Receptor Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:BLyS receptor 3, BAFFR, TNFRSF13C
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10071010 10 µg
RBG10071050 50 µg
RBG10071100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

BAFF Receptor (BAFFR), a member of the TNFR superfamily, is highly expressed in the spleen, lymph nodes, and resting B cells, and to some extent in activated B cells, resting CD4+ cells and peripheral blood leukocytes. BAFFR is a type III transmembrane protein that binds with high specificity to BAFF (TNFSF13B). BAFFR/BAFF signaling plays a critical role in B cell survival and maturation. Recombinant Human BAFFR is a 76 amino acid polypeptide (7.7 kDa) corresponding to the extracellular portion of the full BAFFR protein.

Amino Acid Sequence

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG

Source

E. coli

Purity

95%

Biological Activity

Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 2.0–4.0 µg/ml in the presence of 1.0 µg/ml of human soluble BAFF.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Others

Related Products Documents