Type
Recombinant protein
Description
Betacellulin is an EGF-related polypeptide growth factor that signals through the EGF receptor. It is produced in several tissues, including the pancreas, small intestine, and in certain tumor cells. Betacellulin is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. Betacellulin is initially synthesized as a glycosylated 32.0 kDa transmembrane precursor protein, which is processed by proteolytic cleavage to produce the mature sequence. Recombinant Murine Betacellulin is a 9.0 kDa monomeric protein, containing 80 amino acid residues, which comprises the mature EGF-homologous portion of the Betacellulin protein.
Amino Acid Sequence
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Source
E. coli
Purity
98%
Biological Activity
Determined by its ability to stimulate the proliferation of mouse Balb/3T3 cells. The expected ED50 is 0.01 ≤ ng/ml, corresponding to a specific activity of ≥ 1×108 units/mg.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C
Storage/Expiration
–20°C