Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Betacellulin Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:BTC
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20056005 5 µg
RBG20056020 20 µg
RBG20056100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Betacellulin is an EGF-related polypeptide growth factor that signals through the EGF receptor. It is produced in several tissues, including the pancreas, small intestine, and in certain tumor cells. Betacellulin is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. Betacellulin is initially synthesized as a glycosylated 32.0 kDa transmembrane precursor protein, which is processed by proteolytic cleavage to produce the mature sequence. Recombinant Murine Betacellulin is a 9.0 kDa monomeric protein, containing 80 amino acid residues, which comprises the mature EGF-homologous portion of the Betacellulin protein.

Amino Acid Sequence

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to stimulate the proliferation of mouse Balb/3T3 cells. The expected ED50 is 0.01 ≤ ng/ml, corresponding to a specific activity of ≥ 1×108 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Others, Animal studies

Related Products Docs