Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Betatrophin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:RIFL, Hepatocellular carcinoma-associated protein TD26, C19orf80, UNQ599/PRO1185, Lipasin, Angiopoietin-like protein 8
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172347025 0.025 mg
RD172347100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 187 AA. MW: 21.1 kDa (calculated). UniProtKB acc.no. Q6UXH0 (Ala22-Ala198). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

14% SDS-PAGE separation of Hu Betatrophin:
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and heated sample, 2.5μg/lane
3. non-reduced and non-heated sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05M Acetate buffer pH 4.0

Reconstitution

Add 0.1 M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/mL. In higher concentrations the solubility of this antigen is limited. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Lipoprotein metabolism

Summary

Lipasin (RIFL) is an important new regulator of lipid metabolism that regulates serum triglyceride levels. It is a member of ANGPTL protein family.

References to Summary

References to Betatrophin

  • Espes D, Lau J, Carlsson PO. Increased circulating levels of betatrophin in individuals with long-standing type 1 diabetes. Diabetologia. 2014 Jan;57 (1):50-3
  • Espes D, ORCID: 0000-0001-8843-7941, Martinell M, ORCID: 0000-0002-6060-6229, Carlsson PO, ORCID: 0000-0002-7666-073X. Increased circulating betatrophin concentrations in patients with type 2 diabetes. Int J Endocrinol. 2014;2014:323407
  • Jiao Y, Le Lay J, Yu M, Naji A, Kaestner KH. Elevated mouse hepatic betatrophin expression does not increase human beta-cell replication in the transplant setting. Diabetes. 2014 Apr;63 (4):1283-8
  • Raghow R. Betatrophin: A liver-derived hormone for the pancreatic beta-cell proliferation. World J Diabetes. 2013 Dec 15;4 (6):234-7
  • Salas E, Rabhi N, Froguel P, Annicotte JS. Role of Ink4a/Arf locus in beta cell mass expansion under physiological and pathological conditions. J Diabetes Res. 2014;2014:873679
  • Trebotic LK, Klimek P, Thomas A, Fenzl A, Leitner K, Springer S, Kiefer FW, Kautzky-Willer A. Circulating Betatrophin Is Strongly Increased in Pregnancy and Gestational Diabetes Mellitus. PLoS One. 2015;10 (9):e0136701
  • Wang Y, Quagliarini F, Gusarova V, Gromada J, Valenzuela DM, Cohen JC, Hobbs HH. Mice lacking ANGPTL8 (Betatrophin) manifest disrupted triglyceride metabolism without impaired glucose homeostasis. Proc Natl Acad Sci U S A. 2013 Oct 1;110 (40):16109-14
  • Yi P, Park JS, Melton DA. Betatrophin: a hormone that controls pancreatic beta cell proliferation. Cell. 2013 May 9;153 (4):747-58
  • Zhang R, Abou-Samra AB. A dual role of lipasin (betatrophin) in lipid metabolism and glucose homeostasis: consensus and controversy. Cardiovasc Diabetol. 2014;13:133
Related Products Documents