Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

BMP-3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Osteogenin, BMP-3A
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10083010 10 µg
RBG10083050 50 µg
RBG10083100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling and maintenance of a variety of other tissues and organs. BMP-3 is abundantly found in adult bone and, to a lesser extent, fetal cartilage. BMP-3 inhibits osteogenesis and bone formation by activating a signaling cascade that antagonizes the signaling of pro-osteogenic BMPs. Recombinant Human BMP-3 is a disulfide-linked homodimeric protein that corresponds to residues 361 to 472 of the 472 amino acid BMP-3 precursor protein. The calculated molecular weight of Recombinant Human BMP-3 is 25.2 kDa.

Amino Acid Sequence

MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Source

E. coli

Purity

95%

Biological Activity

Determined by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC-5 cells.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Bone and cartilage metabolism, Cardiovascular disease, Coronary artery disease

Related Products Docs