Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

BMP-5 Human Chinese Hamster Ovary Cells (CHO)

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Chinese Hamster Ovary Cells (CHO)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10086002 2 µg
RBG10086010 10 µg
RBG10086100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling, and maintenance of a variety of other tissues and organs. BMP-5 is expressed in the nervous system, lungs and liver. It is a known regulator for dendritic growth in sympathetic neurons. BMP-5 is a 454 amino acid precursor protein that is cleaved to release the biologically active C-terminal mature protein. Recombinant Human BMP-5 is a 31.2 kDa homodimeric disulfide-linked protein consisting of two identical 138 amino acid chains.

Amino Acid Sequence

AANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

Source

Chinese Hamster Ovary Cells (CHO)

Purity

95%

Biological Activity

Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 0.5–1.0 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism, Neural tissue markers

Related Products Documents