Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

BMP-6 Human HEK293 cells

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:HEK293 cells
  • Other names:VGR
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10087002 2 µg
RBG10087010 10 µg
RBG10087100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant

Description

TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis and apoptosis. As implied by their name, BMPs initiate, promote and regulate the development, growth and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling and maintenance of a variety of other tissues and organs. Increasing evidence indicates that BMP-Smad signaling has a tumor suppressing activity and that BMPs can inhibit tumor growth. BMP-6 is abnormally expressed in breast cancer cell lines; however, its function in promoting breast cancer development is unknown. Recombinant human BMP-6 is a 26.2 kDa homodimeric glycoprotein consisting of two 117 amino acid subunits, which correspond to amino acid residues 397 to 513 of the full-length BMP-6 precursor.

Amino Acid Sequence

VSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Source

HEK293 cells

Purity

95%

Biological Activity

Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 this effect is 0.03–0.06 μg/ml

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Bone and cartilage metabolism, Cardiovascular disease, Coronary artery disease

Related Products Documents