Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Bone Morphogenetic Protein-4 Human HeLa cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HeLa cells
  • Other names:BMP-4
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10084002 2 µg
RBG10084010 10 µg
RBG10084100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

HHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Source

HeLa cells

Purity

97%

Biological Activity

Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 5–10 mM Citric Acid, pH 3.0 to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism

Related Products Docs