Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Brain Fatty Acid Binding Protein Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:FABP7, Brain lipid-binding protein, BLBP, Brain-type fatty acid-binding protein, B-FABP, Fatty acid-binding protein 7, Mammary-derived growth inhibitor related, BLBP, FABPB, MRG
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172249100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 141 AA. MW: 16.0 kDa (calculated). UniProtKB acc.no. O15540. N-Terminal His-tag (10 extra AA)

Amino Acid Sequence

MKHHHHHHASVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

14% SDS-PAGE separation of Human FABP7
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

<1.0 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Summary

Research topic

Neural tissue markers

Related Products Docs