Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

BRAK Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Breast and Kidney-expressed chemokine, CXCL14, bolekine, NJAC, CXCL14
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10092005 5 µg
RBG10092020 20 µg
RBG10092100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Breast and Kidney-expressed chemokine (BRAK) is a CXC chemokine expressed in normal tissue in the absence of inflammatory stimuli, and infrequently expressed in cancer cell lines. BRAK is known to be a highly selective monocyte chemoattractant. However, main function and receptor selectivity is unknown at this time. BRAK contains the four highly conserved cysteine residues present in CXC chemokines. The sequence of the mature protein consists of 87 amino acid residues, and is approximately 30% homologous to the sequences of MIP-2 α and β. Recombinant Human BRAK is a 9.4 kDa protein containing 77 amino acid residues.

Amino Acid Sequence

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Source

E. coli

Purity

98%

Biological Activity

Determined by it's ability to chemoattract activated monocytes using a concentration range of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Oncology

Related Products Docs