Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

C10 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CCL6, MRP-1, CCL6
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20058002 2 µg
RBG20058010 10 µg
RBG20058100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Murine C10 belongs to the CC chemokine family and is expressed in myelopoietic bone marrow cultures when stimulated with GM-CSF, M-CSF, IL-3 or IL-4. It signals primarily through the CCR1 receptor. C10 is chemotactic for B cells, CD4+ T cells, monocytes and NK cells and also exhibits powerful suppressive activity on colony formation by different lineages of hematopoietic progenitors. The C10 contains the four highly conserved cysteine residues present in CC chemokines. The mature protein contains 95 amino acid residues. Recombinant Murine C-10 is a 10.7 kDa protein containing 95 amino acid residues.

Amino Acid Sequence

GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract Balb/c mouse spleen MNCs using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Animal studies

Related Products Docs