Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CCL19 (MIP-3β) Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:MIP-3ß, Beta-chemokine exodus-3, CK beta-11, Epstein-Barr virus-induced molecule 1 ligand chemokine, EBI1 ligand chemokine,ELC, Macrophage inflammatory protein 3 beta, MIP-3-beta, Small-inducible cytokine A19 , C-C motif chemokine 19
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172385050 0.05 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 77 AA. MW: 8,8 kDa (calculated). UniProtKB acc.noQ99731 (22–98) Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Source

E. coli

Purity

Purity as determined by SDS PAGE: > 97%

Biological Activity

EC50 = 7.0 nM determined by Calcium Flux with recombinant human CCR7

Endotoxin

<0.01 EU /1µg

Reconstitution

Add sterile water to prepare a working stock solution of approximately 0.1 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA, Cell culture and/or animal studies, Biologically active protein

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –20 to –70 °C. Lyophilized protein remains stable until the expiry date when stored at-20 to –70 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -20 to –70 °C, the protein is stable for 3 months at –20 to –70 °C under sterile conditions after reconstitution. Reconstituted protein can be stored at 4 °C for 1 month under sterile conditions after reconstitution

Quality Control Test

Quantification is done by A280, using the calculated extinction coefficient (8730 M-1 cm-1).
SDS-PAGE to determine purity of the protein.
LAL TEST to determine endotoxin level.

Note

This product is intended for research use only.

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Summary

Macrophage inflammatory protein-3-beta (MIP3β) (CCL19), also known as EBI1 ligand chemokine (ELC), directs chemotaxis of dendritic cells, and certain B- and T- lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. Being a homeostatic chemokine, its primary physiological role is considered to be in the normal recirculation and homing of lymphocyte. However, MIP3β could also be proinfammatory, and is implicated in the post-HIV infection responses.

Related Products Documents