Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CCL28 (MEC) Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:MEC, Mucosae-associated epithelial chemokine,MEC, Protein CCK1, Small-inducible cytokine A28, CCL28, C-C motif chemokine 28
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172383050 0.05 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 105 AA. MW: 12,1 kDa (calculated). UniProtKB acc.noQ9NRJ3 (23–127) Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Source

E. coli

Purity

Purity as determined by SDS PAGE: >97 %

Biological Activity

EC50 = 38nM determined by Migration Assay in cells expressing recombinant CCR10

Endotoxin

<0.01 EU /1µg

Reconstitution

Add sterile water to prepare a working stock solution of approximately 0.1 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA, Cell culture and/or animal studies, Biologically active protein

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –20 to –70 °C. Lyophilized protein remains stable until the expiry date when stored at-20 to –70 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -20 to –70 °C, the protein is stable for 3 months at –20 to –70 °C under sterile conditions after reconstitution. Reconstituted protein can be stored at 4 °C for 1 month under sterile conditions after reconstitution

Quality Control Test

Quantification is done by A280, using the calculated extinction coefficient (8970 M-1 cm-1).
SDS-PAGE to determine purity of the protein.
LAL TEST to determine endotoxin level.

Note

This product is intended for research use only.

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Summary

Mucosae-associated epithelial chemokine (MEC)(CCL28) is secreted by epithelial cells of gastrointestinal and nonintestinal mucosal cells, and regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. It shows broad-spectrum antibacterial activities, and could also be useful in vaccination of HIV infeaction.

Summary References (3)

References to CCL28

  • Castelletti E, Lo Caputo S, Kuhn L, Borelli M, Gajardo J, Sinkala M, Trabattoni D, Kankasa C, Lauri E, Clivio A, Piacentini L, Bray DH, Aldrovandi GM, Thea DM, Veas F, Nebuloni M, Mazzotta F, Clerici M. The mucosae-associated epithelial chemokine (MEC/CCL28) modulates immunity in HIV infection. PLoS One. 2007;2 (10):e969
  • Pan J, Kunkel EJ, Gosslar U, Lazarus N, Langdon P, Broadwell K, Vierra MA, Genovese MC, Butcher EC, Soler D. A novel chemokine ligand for CCR10 and CCR3 expressed by epithelial cells in mucosal tissues. J Immunol. 2000 Sep 15;165 (6):2943-9
  • Wang W, Soto H, Oldham ER, Buchanan ME, Homey B, Catron D, Jenkins N, Copeland NG, Gilbert DJ, Nguyen N, Abrams J, Kershenovich D, Smith K, McClanahan T, Vicari AP, Zlotnik A. Identification of a novel chemokine (CCL28), which binds CCR10 (GPR2). J Biol Chem. 2000 Jul 21;275 (29):22313-23
Related Products Docs