Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CCL3 (MIP-1α) Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:MIP-1α, C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1 Macrophage inflammatory protein 1-alpha, PAT 464.1, SIS-beta, Small-inducible cytokine A3, Tonsillar lymphocyte LD78 alpha protein, G0S19-1, MIP1A, SCYA3, CCL3
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172389050 0.05 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 69 AA. MW: 7,7 kDa (calculated). UniProtKB acc.no# P10147 (24–92) Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Source

E. coli

Purity

> 97% by SDS PAGE

Biological Activity

EC50 = 0.1–0.3nM determined by Migration Assay in cells expressing recombinant CCR5

Endotoxin

<0.01 EU/1µg

Reconstitution

Add sterile water to prepare a working stock solution of approximately 0.1 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA, Cell culture and/or animal studies, Biologically active protein

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –20 to –70 °C. Lyophilized protein remains stable until the expiry date when stored at-20 to –70 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -20 to –70 °C, the protein is stable for 3 months at –20 to –70 °C under sterile conditions after reconstitution. Reconstituted protein can be stored at 4 °C for 1 month under sterile conditions after reconstitution

Quality Control Test

Quantification is done by A280, using the calculated extinction coefficient (10010 M-1 cm-1).
SDS-PAGE to determine purity of the protein.
LAL TEST to determine endotoxin level.

Note

This product is intended for research use only.

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Summary

Macrophage inflammatory proteins 1-α (MIP1α)(CCL3) binds to cell surface receptors CCR1 and CCR5. It is proinflammatory, leading to chemotaxis and activation of immune cells. It also inhibits proliferation of hematopoietic stem cells. Moreover, by binding to one of the HIV coreceptors, CCR5, it suppresses HIV infection.

Related Products Docs