Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CDNF Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:ARMET-Like Protein 1, ARMETL1, Conserved Dopamine Neurotrophic Factor, Cerebral Dopamine Neurotrophic Factor
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10103005 5 µg
RBG10103025 25 µg
RBG10103100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

CDNF is a secreted neurotrophic factor that is expressed in brain, neuronal and certain non-neuronal tissues. It has been shown to promote survival, growth and function of dopamine specific neurons. CDNF and its structural homolog MANF, each contain an N-terminal saposin-like lipid binding domain, and a carboxyl-terminal domain, which is not homologous to previously characterized protein structures. CDNF and MANF can prevent 6-OHDA induced degeneration of dopaminergic neurons by triggering survival pathways in a rat experimental model of Parkinson disease.

Amino Acid Sequence

MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 for this effect is 15–25 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Neural tissue markers

Related Products Docs