Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CNTF Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Ciliary Neurotrophic Factor
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10105005 5 µg
RBG10105020 20 µg
RBG10105100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

CNTF is a potent neural factor that was originally characterized as a vital factor for the survival of chick ciliary neurons in vitro. CNTF is also important for the survival of other neural cell types, including primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF is highly conserved across species and exhibits cross-species bioactivity. Recombinant Human CNTF is synthesized as a 199 amino acid polypeptide (22.8 kDa) lacking a hydrophobic N-terminal signal for secretion.

Amino Acid Sequence

AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTQSYVKHQGLNKNINLDSADGMPVASTDQWSQLTQAQRLQQNLQAYRTFHVLLARLLQDQQVHFTPTQGDFHQAIHTLLLQVAAFAYQIQQLMILLQYKIPRNQADGMPINVGDGGLFQKKLWGLKVLQQLSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to stimulate proliferation of human TF-1 cells using an ED50 concentration range of 50–150 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 5–10 mM Sodium Phosphate, pH 7.5 to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Bone and cartilage metabolism, Cardiovascular disease, Coronary artery disease, Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Neural tissue markers

Related Products Documents