Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Cornifin-B Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:SPRR1B, 14.9 kDa pancornulin, Small proline-rich protein IB, SPR-IB
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172320100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 97 AA. MW: 10.9 kDa (calculated). UniProtKB acc.no. P22528 (Ser2-Lys89). N-Terminal His-tag (9 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

14% SDS-PAGE separation of Human Cornifin
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and boiled sample, 2.5μg/lane
3. non-reduced and non-boiled sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/ml in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4

Reconstitution

Add 200μl of deionized water to prepare a working stock solution of 0.5 mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Others, Reproduction

Summary

Cornifin-B occurs in keratinocytes. It is cross-linked to membrane proteins by transglutaminase which leads to formation of an insoluble envelope. It is expressed during differentiation in squamous tissues such as epidermis, esophagus, tongue or trachea.

Related Products Docs