Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CTACK Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Cuteaneous T-cell Attracting Chemokine, CCL27, ALP, Skinkine, Eskine, CCL27
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10106005 5 µg
RBG10106020 20 µg
RBG10106100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

CTACK is a keratinocyte-derived CC chemokine which signals through the CCR10 receptor. Both CTACK and CCR10 are expressed in normal and irritated epithelial cells. CTACK selectively attracts CLA+ T-cells and directs them into the skin. CTACK contains the four highly conserved cysteine residues present in most CC chemokines. The mature protein contains 88 amino acid residues. Recombinant Human CTACK is a 10.2 kDa protein containing 88 amino acid residues.

Amino Acid Sequence

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract CXCR3 transfected cells using a concentration of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation

Related Products Documents