Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CTGFL/WISP-2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Connective Tissue Growth Factor-Like protein, CCN5, CT-58
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10108005 5 µg
RBG10108020 20 µg
RBG10108100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

CTGFL/WISP-2 is a 28.6 kDa protein that belongs to the CCN family of cysteine-rich regulatory proteins. Members of this family stimulate mitosis, adhesion, apoptosis, extracellular matrix production, growth arrest, and migration of multiple cell types. The protein is expressed in primary osteoblasts, fibroblasts, the ovaries, testes, and heart. In addition to promoting adhesion of osteoblasts, CTGFL/WISP-2 inhibits osteocalcin production, as well as binding of fibrinogen to integrin receptors. Recombinant Human CTGFL/WISP-2 is a 24.3 kDa protein consisting of 228 amino acid residues. Mature human CTGFL/WISP-2 is a 24.8 kDa polypeptide protein containing 227 amino acids. It is composed of 3 distinct domains; the IGF-Binding Protein domain (IGF-BP), the Thrombospondin type I repeat (TSP type I), and von Willebrand Factor C motif (VWFC).

Amino Acid Sequence

MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Source

E. coli

Purity

95%

Biological Activity

The ED50 was determined by its ability to inhibit IGF-II induced proliferation of MCF-7 is between 10–20 ng/ml in the presence of 15 ng/ml of human IGF-II.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Note: Do not raise to neutral pH. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Coronary artery disease

Related Products Documents