Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CTRP4 Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Complement C1q tumor necrosis factor-related protein 4, C1QTNF4, CTRP4, ZACRP4, C1q And Tumor Necrosis Factor Related Protein 4
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172177100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 319 AA. MW: 34.5 kDa (calculated). UniProtKB acc. No. Q9BXJ3 (Leu17–Leu329). C-terminal His-tag (6 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

LGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNIGGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELLHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 85 %

SDS-PAGE Gel

12 % SDS-PAGE separation of Human CTRP4:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

0.25–0.70 mg/ml solution in phosphate buffered saline, filtered (0.4 μm), frozen.

Reconstitution

Defrost at ambient temperature.Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Related Products Documents