Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CTRP8 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:C1q/TNF-related protein 8, CTRP8, C1QTNF8, UNQ5829/PRO19648
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172179100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 255 AA. MW: 28,4 kDa (calculated). UniProtKB acc.no. P60827. N-Terminal His-tag, 10 extra AA (highlighted).

Amino Acid Sequence

MKHHHHHHASWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSGHLVKPAAEL

Source

E. coli

SDS-PAGE Gel

14% SDS-PAGE separation of Human CTRP8
1. reduced and heated sample, 5μg / lane
2. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
3. non-reduced and non-heated sample, 5μg / lane

Endotoxin

< 1.0 EU/μg

Formulation

0.2–0.6 mg/ml in 0.03M acetate buffer, pH=4.0 – filtered (0.4 μm), frozen

Reconstitution

Defrost at ambient temperature. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/mL. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation

Related Products Documents