Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CXCL16 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:SRPSOX
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10109005 5 µg
RBG10109020 20 µg
RBG10109100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

CXCL16 is a member of the CXC chemokine family and signals through the CXCR6 receptor. CXCL16 may play a role in attracting lymphocyte subsets during inflammation and may facilitate certain immune responses. The chemokine domain of CXCL16 contains six cysteine residues, including the four highly conserved cysteine residues characteristic of CXC chemokines. The CXCL16 gene codes for a 273 amino acid polypeptide, which includes a 29 amino acid cytoplasmic domain and transmembrane sequence containing approximately 20 amino acids. The extracellular portion of CXCL16 contains a chemokines domain and an extended C-terminal “mucin-like stalk” sequence. The extracellular domain contains 89 amino acid residues (86 a.a. residues for the murine homolog). Recombinant Human CXCL16 is a 10.1 kDa protein containing 89 amino acid residues.

Amino Acid Sequence

NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLP

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract activated lymphocytes using a concentration of 1.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation

Related Products Docs