CXCL8 (IL-8) Human E. coli

Cat. No.	Size	Price
RD172388050	0.05 mg

Technical Data

Type

Recombinant protein

Description

Total 72 AA. MW: 8,4 kDa (calculated). UniProtKB acc.no.P10145 (28–99) Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Source

E. coli

Purity

Purity as determined by SDS PAGE: > 97%

Biological Activity

EC50 = 0.083nM determined by Migration Assay in cells expressing recombinant CXCR1

Endotoxin

<0.01 EU /1µg

Reconstitution

Add sterile water to prepare a working stock solution of approximately 0.1 mg/ml and let the lyophilized pellet dissolve completely.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –20 to –70 °C. Lyophilized protein remains stable until the expiry date when stored at-20 to –70 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -20 to –70 °C, the protein is stable for 3 months at –20 to –70 °C under sterile conditions after reconstitution. Reconstituted protein can be stored at 4 °C for 1 month under sterile conditions after reconstitution

Note

This product is intended for research use only.

Summary

Research topic

Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Oncology, Sepsis

Summary

IL-8 (8 kDa, 72 amino acids) is a non-glycosylated protein and it is produced by the processing of a precursor protein of 99 amino acids. IL-8 is present in the synovial fluids of patients with rheumatoid arthritis and has been purified from plaque psoriasis scales. It is associated with sepsis, asthma and glomerulonephritis.

Summary References (20)

References to Interleukin-8

Baggiolini M, Clark-Lewis I. Interleukin-8, a chemotactic and inflammatory cytokine. FEBS Lett. 1992 Jul 27;307 (1):97-101
Brat DJ, Bellail AC, Van Meir EG. The role of interleukin-8 and its receptors in gliomagenesis and tumoral angiogenesis. Neuro Oncol. 2005 Apr;7 (2):122-33
Burrows SD, Doyle ML, Murphy KP, Franklin SG, White JR, Brooks I, McNulty DE, Scott MO, Knutson JR, Porter D, et al. Determination of the monomer-dimer equilibrium of interleukin-8 reveals it is a monomer at physiological concentrations. Biochemistry. 1994 Nov 01;33 (43):12741-5
DeForge LE, Fantone JC, Kenney JS, Remick DG. Oxygen radical scavengers selectively inhibit interleukin 8 production in human whole blood. J Clin Invest. 1992 Nov;90 (5):2123-9
DeForge LE, Preston AM, Takeuchi E, Kenney J, Boxer LA, Remick DG. Regulation of interleukin 8 gene expression by oxidant stress. J Biol Chem. 1993 Dec 05;268 (34):25568-76
Donnelly SC, Strieter RM, Kunkel SL, Walz A, Robertson CR, Carter DC, Grant IS, Pollok AJ, Haslett C. Interleukin-8 and development of adult respiratory distress syndrome in at-risk patient groups. Lancet. 1993 Mar 13;341 (8846):643-7
Holmes WE, Lee J, Kuang WJ, Rice GC, Wood WI. Structure and functional expression of a human interleukin-8 receptor. Science. 1991 Sep 13;253 (5025):1278-80
Huang GT, Potente AP, Kim JW, Chugal N, Zhang X. Increased interleukin-8 expression in inflamed human dental pulps. Oral Surg Oral Med Oral Pathol. 1999 Aug;88 (2):214-20
Kauma S, Takacs P, Scordalakes C, Walsh S, Green K, Peng T. Increased endothelial monocyte chemoattractant protein-1 and interleukin-8 in preeclampsia. Obstet Gynecol. 2002 Oct;100 (4):706-14
Lemster BH, Carroll PB, Rilo HR, Johnson N, Nikaein A, Thomson AW. IL-8/IL-8 receptor expression in psoriasis and the response to systemic tacrolimus (FK506) therapy. Clin Exp Immunol. 1995 Feb;99 (2):148-54
Livaditi O, Kotanidou A, Psarra A, Dimopoulou I, Sotiropoulou C, Augustatou K, Papasteriades C, Armaganidis A, Roussos C, Orfanos SE, Douzinas EE. Neutrophil CD64 expression and serum IL-8: sensitive early markers of severity and outcome in sepsis. Cytokine. 2006 Dec;36 (5-6):283-90
Matsushima K, Oppenheim JJ. Interleukin 8 and MCAF: novel inflammatory cytokines inducible by IL 1 and TNF. Cytokine. 1989 Nov;1 (1):2-13
Mukaida N. Pathophysiological roles of interleukin-8/CXCL8 in pulmonary diseases. Am J Physiol Lung Cell Mol Phy. 2003 Apr;284 (4):L566-77
Mukaida N, Harada A, Yasumoto K, Matsushima K. Properties of pro-inflammatory cell type-specific leukocyte chemotactic cytokines, interleukin 8 (IL-8) and monocyte chemotactic and activating factor (MCAF). Microbiol Immunol. 1992;36 (8):773-89
Mukaida N, Morita M, Ishikawa Y, Rice N, Okamoto S, Kasahara T, Matsushima K. Novel mechanism of glucocorticoid-mediated gene repression. Nuclear factor-kappa B is target for glucocorticoid-mediated interleukin 8 gene repression. J Biol Chem. 1994 May 06;269 (18):13289-95
Paolini JF, Willard D, Consler T, Luther M, Krangel MS. The chemokines IL-8, monocyte chemoattractant protein-1, and I-309 are monomers at physiologically relevant concentrations. J Immunol. 1994 Sep 15;153 (6):2704-17
Sharma A, Satyam A, Sharma JB. Leptin, IL-10 and inflammatory markers (TNF-alpha, IL-6 and IL-8) in pre-eclamptic, normotensive pregnant and healthy non-pregnant women. Am J Reprod Immunol. 2007 Jul;58 (1):21-30
Teles RP, Likhari V, Socransky SS, Haffajee AD. Salivary cytokine levels in subjects with chronic periodontitis and in periodontally healthy individuals: a cross-sectional study. J Periodontal Res. 2009 Jun;44 (3):411-7
Tsai CC, Ho YP, Chen CC. Levels of interleukin-1 beta and interleukin-8 in gingival crevicular fluids in adult periodontitis. J Periodontol. 1995 Oct;66 (10):852-9
Waugh DJ, Wilson C. The interleukin-8 pathway in cancer. Clin Cancer Res. 2008 Nov 01;14 (21):6735-41

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)