Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Cyclophilin H Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Peptidyl-prolyl cis-trans isomerase H, PPIase H, Rotamase H, Small nuclear ribonucleoprotein particle-specific cyclophilin H, CypH, U-snRNP-associated cyclophilin SnuCyp-20, USA-CYP
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172366050 0.05 mg
RD172366100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 186 AA. MW: 20.3 kDa (calculated). UniProtKB acc.no. O43447 (Ala2-Met177). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

14 % SDS-PAGE separation of Human Peptidyl-prolyl Cis-trans Isomerase H:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5 μg/lane
3. non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/mL solution in phosphate buffered saline pH 7,4.

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Summary

Cyclophilins promote protein folding. Cyclophilin H enables the cis-trans isomerization of proline imidic peptide bonds. It takes part in pre-mRNA splicing and assembly of the U4/U5/U6 tri-snRNP complex in the spliceosome.

Related Products Documents