Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Cysteine-Rich Secretory Protein 2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CRISP-2, Cancer/testis antigen 36, CT36, Testis-specific protein TPX-1, CRISP2 ,GAPDL5, TPX1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172261100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Recombinant protein contains amino acids no. 22–243 of the protein acc.no. P16562 in UniProtKB. Total 232 AA. MW: 26.32 kDa (calculated). N-Terminal His-tag (10 extra AA)

Amino Acid Sequence

MKHHHHHHASKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >90 %

SDS-PAGE Gel

14 % SDS-PAGE separation of Human Cysteine-rich secretory protein 2:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5 μg/lane
3. non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

0.3 – 0.5 mg/ml in 50 mM acetate buffer, pH 4, 5mM DTT 20%glycerol. – filtered (0.4 μm), frozen

Reconstitution

Defrost at ambient temperature. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles.

Quality Control Test

Bradford protein assay to determine quantity of the protein.
SDS-PAGE to determine purity of the protein.
LAL TEST to determine endotoxin level.

Note

This product is intended for research use only.

Summary

Research topic

Reproduction

Related Products Docs