Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Cysteine-Rich Secretory Protein 3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CRISP-3, Specific Granule Protein (28 KDa), CRS3, SGP28, Aeg2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172262100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Recombinant protein contains amino acids no. 21–245 of the protein acc.no. P54108 in UniProtKB. Total 235 AA. MW: 26.74 kDa (calculated). N-Terminal His-tag (10 extra AA)

Amino Acid Sequence

MKHHHHHHASNEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 85%

SDS-PAGE Gel

14 % SDS-PAGE separation of Human Cysteine-rich secretory protein 3:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5 μg/lane
3. non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

0.3 – 0.5 mg/ml in 50 mM acetate buffer, pH 4, 5mM DTT 20%glycerol. – filtered (0.4 μm), frozen

Reconstitution

Defrost at ambient temperature. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles.

Quality Control Test

Bradford protein assay to determine quantity of the protein.
SDS-PAGE to determine purity of the protein.
LAL TEST to determine endotoxin level.

Note

This product is intended for research use only.

Summary

Research topic

Oncology, Reproduction

Summary

Cysteine-rich secretory protein 3 (CRISP-3, SGP 28) belongs to the CRISP family of proteins having a PR-1 (pathogenesis related protein 1) domain at its N-terminal and ion channel regulatory (ICR) domain at its C-terminal connected by a hinge region. CRISP-3 transcripts are shown to be present predominantly in the prostate. Its expression is low in benign prostatic epithelium but is highly upregulated in the majority of high-grade prostatic intraepithelial neoplasia lesions and in most primary prostate tumours and metastases. Two independent studies have shown that CRISP-3 is one of the genes that are most often upregulated in prostate cancer. Human Prostate Secretory Protein (PSP94) has been shown to bind human CRISP-3 with very high affinity. Functional significance of this complex is not yet known. Yet, it was suggested, that involvement of the hinge region of CRISPs in interaction with PSP94 may affect the domain movement of CRISPs essential for the ion-channel regulatory activity resulting in inhibition of this activity.

References to Summary

References to Cysteine-Rich Secretory Protein 3

  • Breed AA, Gomes A, Roy BS, Mahale SD, Pathak BR. Mapping of the binding sites involved in PSP94-CRISP-3 interaction by molecular dissection of the complex. Biochim Biophys Acta. 2013 Apr;1830 (4):3019-29
  • Pathak BR, Breed AA, Nakhawa VH, Jagtap DD, Mahale SD. Growth inhibition mediated by PSP94 or CRISP-3 is prostate cancer cell line specific. Asian J Androl. 2010 Sep;12 (5):677-89
Related Products Documents