Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Cytokine-Like Protein 1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CYTL1, C4orf4, UNQ1942/PRO4425
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172265100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 124 AA. MW: 14.6 kDa (calculated). N-Terminal His-tag (10 extra AA). UniprotKB acc.no. Q9NRR1 (Thr23-Arg136)

Amino Acid Sequence

MKHHHHHHASTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

14% SDS-PAGE separation of CYTL1:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 2.5μg / lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 20mM Tris buffer, 50mM NaCl, pH 7.5

Reconstitution

Add 200ul of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Bone and cartilage metabolism

Summary

Cytokine-like protein 1 is a secreted protein. It is expressed in CD34+ cell populations of bone marrow and cord blood which function as hematopoietic stem/progenitor cells. It is not expressed in CD34– cells. Experiments with knock-out mice (Cytl1-/-) suggest that CYTL1 is required for the maintenance of cartilage homeostasis rather than cartilage and bone development, and loss of CYTL1 function is associated with experimental osteoarthritic cartilage destruction in mice.

Related Products Docs