Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

E-Selectin Human Chinese Hamster Ovary Cells (CHO)

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Chinese Hamster Ovary Cells (CHO)
  • Other names:ELAM1, endothelial adhesion molecule 1, CD62E
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10127010 10 µg
RBG10127050 50 µg
RBG10127100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Selectins are a family of calcium-dependent type 1 transmembrane proteins. Endothelial (E)-selectin is a heavily glycosylated transmembrane protein expressed by activated endothelial cells in microvascular linings. E-selectin, along with P-selectin and L-selectin, initiate recruitment of circulating leukocytes from blood to sites of inflammation in the vascular lining through interaction with specific cell surface-associated carbohydrate determinants. E-selectin consists of an N-terminal type 1 lectin domain, an EGF-like domain, 6 sushi (CCP/SCR) domains, a transmembrane sequence, and a short cytoplasmic domain. Recombinant Human E-selectin is a 58.6 kDa protein containing 535 amino acid residues, corresponding to the extracellular portion of the full length protein. Due to glycosylation, E-selectin migrates at an apparent molecular weight of approximately 65–85 kDa by SDS-PAGE analysis under reducing conditions.

Amino Acid Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Source

Chinese Hamster Ovary Cells (CHO)

Purity

95%

Biological Activity

Measured by its ability to support adhesion of U937 cells, a human hystiocytic lymphoma cell line.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cell adhesion proteins, Immune Response, Infection and Inflammation, Transplantation

Summary References (15)

References to E-Selectin

  • Brasch J, Sterry W. Expression of adhesion molecules in early allergic patch test reactions. Dermatology. 1992;185 (1):12-7
  • Duguid IG, Boyd AW, Mandel TE. Adhesion molecules are expressed in the human retina and choroid. Curr Eye Res. 1992;11 Suppl:153-9
  • Engelberts I, Samyo SK, Leeuwenberg JF, van der Linden CJ, Buurman WA. A role for ELAM-1 in the pathogenesis of MOF during septic shock. J Surg Res. 1992 Aug;53 (2):136-44
  • Foxall C, Watson SR, Dowbenko D, Fennie C, Lasky LA, Kiso M, Hasegawa A, Asa D, Brandley BK. The three members of the selectin receptor family recognize a common carbohydrate epitope, the sialyl Lewis(x) oligosaccharide. J Cell Biol. 1992 May;117 (4):895-902
  • Gundel RH, Wegner CD, Torcellini CA, Clarke CC, Haynes N, Rothlein R, Smith CW, Letts LG. Endothelial leukocyte adhesion molecule-1 mediates antigen-induced acute airway inflammation and late-phase airway obstruction in monkeys. J Clin Invest. 1991 Oct;88 (4):1407-11
  • Koizumi M, King N, Lobb R, Benjamin C, Podolsky DK. Expression of vascular adhesion molecules in inflammatory bowel disease. Gastroenterology. 1992 Sep;103 (3):840-7
  • Kyan-Aung U, Haskard DO, Poston RN, Thornhill MH, Lee TH. Endothelial leukocyte adhesion molecule-1 and intercellular adhesion molecule-1 mediate the adhesion of eosinophils to endothelial cells in vitro and are expressed by endothelium in allergic cutaneous inflammation in vivo. J Immunol. 1991 Jan 15;146 (2):521-8
  • Lasky LA. Lectin cell adhesion molecules (LEC-CAMs): a new family of cell adhesion proteins involved with inflammation. J Cell Biochem. 1991 Feb;45 (2):139-46
  • Lawrence MB, Springer TA. Leukocytes roll on a selectin at physiologic flow rates: distinction from and prerequisite for adhesion through integrins. Cell. 1991 May 31;65 (5):859-73
  • Mulligan MS, Varani J, Dame MK, Lane CL, Smith CW, Anderson DC, Ward PA. Role of endothelial-leukocyte adhesion molecule 1 (ELAM-1) in neutrophil-mediated lung injury in rats. J Clin Invest. 1991 Oct;88 (4):1396-406
  • Munro JM, Pober JS, Cotran RS. Recruitment of neutrophils in the local endotoxin response: association with de novo endothelial expression of endothelial leukocyte adhesion molecule-1. Lab Invest. 1991 Feb;64 (2):295-9
  • Pigott R, Dillon LP, Hemingway IH, Gearing AJ. Soluble forms of E-selectin, ICAM-1 and VCAM-1 are present in the supernatants of cytokine activated cultured endothelial cells. Biochem Biophys Res Commun. 1992 Sep 16;187 (2):584-9
  • Redl H, Dinges HP, Buurman WA, van der Linden CJ, Pober JS, Cotran RS, Schlag G. Expression of endothelial leukocyte adhesion molecule-1 in septic but not traumatic/hypovolemic shock in the baboon. Am J Pathol. 1991 Aug;139 (2):461-6
  • Shimizu Y, Shaw S, Graber N, Gopal TV, Horgan KJ, Van Seventer GA, Newman W. Activation-independent binding of human memory T cells to adhesion molecule ELAM-1. Nature. 1991 Feb 28;349 (6312):799-802
  • Von Andrian UH, Hansell P, Chambers JD, Berger EM, Torres Filho I, Butcher EC, Arfors KE. L-selectin function is required for beta 2-integrin-mediated neutrophil adhesion at physiological shear rates in vivo. Am J Physiol. 1992 Oct;263 (4 Pt 2):H1034-44
Related Products Docs