Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

EG-VEGF Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Endocrine Gland-derived Vascular Endothelial Growth Factor, Prokineticin 1, PROK1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10117005 5 µg
RBG10117020 20 µg
RBG10117100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF

Source

E. coli

Purity

98%

Biological Activity

Data not available at this time.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease

Related Products Documents