Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

EGF Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant, Animal-Free manufactured
  • Source:E. coli
  • Other names:Epidermal Growth Factor, Urogastrone, URG
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG101150100 100 μg
RBG101151000 1mg
RBG101150500 500 μg
PubMed Product Details
Technical Data

Type

Recombinant, Animal-Free manufactured

Amino Acid Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Source

E. coli

Purity

>98% by SDS-PAGE gell and HPLC analysis

Biological Activity

Determined by its ability to stimulate the proliferation of mouse balb/c 3T3 cells. The ED50 is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1×107 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 5% Trehalose) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Neural tissue markers, Oncology

Related Products Documents